From: lily jin (lily1907_at_yahoo.com)
Date: Mon May 22 2006 - 15:19:57 CDT
Thanks for trying help. I want to keep the existing helix, and add one more turn at its end. For example:
the sequence is
1 TRYQQIDEDEAALFLTTTTKGKLTVERKTEMKTSGSTIK
the existing structure is
1 cccccccchhhhhhhhhhhhhhhhhhhhccccccccccc
I want to make a tructure like:
1 cccccccchhhhhhhhhhhhhhhhhhhhhhhhcccccc
where 'c' means loop and 'h' mean helix
I want to keep the structure for the first 28 residues intact, but the next four residues to continue the helix structure.
Am I making it clear? Please let me know if still not. Thanks a lot!
hl332_at_drexel.edu wrote:i did not actually understand your question clearly. can you explain a bit more about it. If you want to remove a helix totally, you can always do it changing respective pdb file. You can delete whatever you wish to. But i guess you are thinking something else.please let me know.
Harish Vashisth
Graduate Student(Ph.D)
CAT-361,Department of Chemical & Biological Engg.
Drexel University, Philadelphia, PA
office: 215-895-5823
----- Original Message -----
From: lily jin
Date: Monday, May 22, 2006 2:16 pm
Subject: namd-l: make the helix longer
> Hi,
> I have a helix of 4 turns in my structure. Now I want to prolong
> the helix into a five-turn helix. It is to say, change a fex
> residues in the loop next to the helix into an helix turn. How is
> it possible to do so with NAMD? Thanks a lot!
>
>
> Lily
>
> ---------------------------------
> Blab-away for as little as 1¢/min. Make PC-to-Phone Calls using
> Yahoo! Messenger with Voice.
>
Lily
---------------------------------
Love cheap thrills? Enjoy PC-to-Phone calls to 30+ countries for just 2¢/min with Yahoo! Messenger with Voice.
This archive was generated by hypermail 2.1.6 : Wed Feb 29 2012 - 15:42:04 CST